Growth Arrest Specific Protein 7 (GAS7) (NM_201432) Human Recombinant Protein
CAT#: TP300285
Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant b
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC200285 protein sequence
Red=Cloning site Green=Tags(s) MKPGMVPPPPGEESQTVILPPGWQSYLSPQGRRYYVNTTTNETTWERPSSSPGIPASPGSHRSSLPPTVN GYHASGTPAHPPETAHMSVRKSTGDSQNLGSSSPSKKQSKENTITINCVTFPHPDTMPEQQLLKPTEWSY CDYFWADKKDPQGNGTVAGFELLLQKQLKGKQMQKEMSEFIRERIKIEEDYAKNLAKLSQNSLASQEEGS LGEAWAQVKKSLADEAEVHLKFSAKLHSEVEKPLMNFRENFKKDMKKCDHHIADLRKQLASRYASVEKAR KALTERQRDLEMKTQQLEIKLSNKTEEDIKKARRKSTQAGDDLMRCVDLYNQAQSKWFEEMVTTTLELER LEVERVEMIRQHLCQYTQLRHETDMFNQSTVEPVDQLLRKVDPAKDRELWVREHKTGNIRPVDMEI myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.5 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_958836 |
Locus ID | 8522 |
UniProt ID | O60861 |
Cytogenetics | 17p13.1 |
Refseq Size | 8181 |
Refseq ORF | 1248 |
Summary | Growth arrest-specific 7 is expressed primarily in terminally differentiated brain cells and predominantly in mature cerebellar Purkinje neurons. GAS7 plays a putative role in neuronal development. Several transcript variants encoding proteins which vary in the N-terminus have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404414 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC404415 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 155.00 |
|
LC418527 | GAS7 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY404414 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant b |
USD 325.00 |
|
LY404415 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant c |
USD 495.00 |
|
LY418527 | Transient overexpression lysate of growth arrest-specific 7 (GAS7), transcript variant a |
USD 325.00 |
|
PH300285 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_958836) |
USD 2,055.00 |
|
PH315256 | GAS7 MS Standard C13 and N15-labeled recombinant protein (NP_003635) |
USD 2,055.00 |
|
TP315256 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant a |
USD 748.00 |
|
TP720200 | Recombinant protein of human growth arrest-specific 7 (GAS7), transcript variant d |
USD 300.00 |
{0} Product Review(s)
Be the first one to submit a review