LSM1 (NM_014462) Human Mass Spec Standard

CAT#: PH300288

LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277)

Product Images

Coomassie blue staining of purified LSM1 protein (Cat# TP300288). The protein was produced from HEK293T cells transfected with LSM1 cDNA clone (Cat# RC200288) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200288
• Predicted MW: 15.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200288 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN
  VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055277
• RefSeq Size: 1161
• RefSeq ORF: 399
• Synonyms: CASM; YJL124C
• Locus ID: 27257
• UniProt ID: O15116, A0A0S2Z590
• Cytogenetics: 8p11.23
• Summary: This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011]
• Protein Families: Stem cell - Pluripotency
• Protein Pathways: RNA degradation