LSM1 (NM_014462) Human Recombinant Protein
CAT#: TP300288
Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200288 protein sequence
Red=Cloning site Green=Tags(s) MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 15 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_055277 |
| Locus ID | 27257 |
| UniProt ID | O15116, A0A0S2Z590 |
| Cytogenetics | 8p11.23 |
| Refseq Size | 1161 |
| Refseq ORF | 399 |
| Synonyms | CASM; YJL124C |
| Summary | This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011] |
| Protein Families | Stem cell - Pluripotency |
| Protein Pathways | RNA degradation |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415265 | LSM1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY415265 | Transient overexpression lysate of LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
USD 436.00 |
|
| PH300288 | LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277) |
USD 2,055.00 |
|
| TP720235 | Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) |
USD 330.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China