EEF1B2 (NM_021121) Human Mass Spec Standard

CAT#: PH300733

EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944)

Product Images

Coomassie blue staining of purified EEF1B2 protein (Cat# TP300733). The protein was produced from HEK293T cells transfected with EEF1B2 cDNA clone (Cat# RC200733) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200733
• Predicted MW: 24.8 kDa
• Protein Sequence:
  Sequence Link

  >RC200733 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP
  GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS
  SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF
  EDYVQSMDVAAFNKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_066944
• RefSeq Size: 854
• RefSeq ORF: 675
• Synonyms: EEF1B; EEF1B1; EF1B
• Locus ID: 1933
• UniProt ID: P24534, A0A024R3W7
• Cytogenetics: 2q33.3
• Summary: 'This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008]'