EEF1B2 (NM_021121) Human Recombinant Protein
CAT#: TP300733
Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC200733 protein sequence
Red=Cloning site Green=Tags(s) MGFGDLKSPAGLQVLNDYLADKSYIEGYVPSQADVAVFEAVSSPPPADLCHALRWYNHIKSYEKEKASLP GVKKALGKYGPADVEDTTGSGATDSKDDDDIDLFGSDDEEESEEAKRLREERLAQYESKKAKKPALVAKS SILLDVKPWDDETDMAKLEECVRSIQADGLVWGSSKLVPVGYGIKKLQIQCVVEDDKVGTDMLEEQITAF EDYVQSMDVAAFNKI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.6 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_066944 |
| Locus ID | 1933 |
| UniProt ID | P24534, A0A024R3W7 |
| Cytogenetics | 2q33.3 |
| Refseq Size | 854 |
| Refseq ORF | 675 |
| Synonyms | EEF1B; EEF1B1; EF1B |
| Summary | This gene encodes a translation elongation factor. The protein is a guanine nucleotide exchange factor involved in the transfer of aminoacylated tRNAs to the ribosome. Alternative splicing results in three transcript variants which differ only in the 5' UTR. [provided by RefSeq, Jul 2008] |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400721 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC412075 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC421974 | EEF1B2 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY400721 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1 |
USD 436.00 |
|
| LY412075 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 2 |
USD 436.00 |
|
| LY421974 | Transient overexpression lysate of eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3 |
USD 436.00 |
|
| PH300733 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_066944) |
USD 2,055.00 |
|
| PH309768 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001032752) |
USD 2,055.00 |
|
| PH321264 | EEF1B2 MS Standard C13 and N15-labeled recombinant protein (NP_001950) |
USD 2,055.00 |
|
| TP309768 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 3 |
USD 823.00 |
|
| TP321264 | Recombinant protein of human eukaryotic translation elongation factor 1 beta 2 (EEF1B2), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China