HSPC150 (UBE2T) (NM_014176) Human Mass Spec Standard

CAT#: PH300748

UBE2T MS Standard C13 and N15-labeled recombinant protein (NP_054895)

Product Images

Coomassie blue staining of purified UBE2T protein (Cat# TP300748). The protein was produced from HEK293T cells transfected with UBE2T cDNA clone (Cat# RC200748) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200748
• Predicted MW: 22.5 kDa
• Protein Sequence:
  Sequence Link

  >RC200748 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF
  LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL
  KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054895
• RefSeq Size: 935
• RefSeq ORF: 591
• Synonyms: FANCT; HSPC150; PIG50
• Locus ID: 29089
• UniProt ID: Q9NPD8, A0A024R9A9
• Cytogenetics: 1q32.1
• Summary: The protein encoded by this gene catalyzes the covalent attachment of ubiquitin to protein substrates. Defects in this gene have been associated with Fanconi anemia of complementation group T. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
• Protein Families: Druggable Genome