HSPC150 (UBE2T) (NM_014176) Human Recombinant Protein

CAT#: TP300748

Recombinant protein of human ubiquitin-conjugating enzyme E2T (putative) (UBE2T)

Product Images

Coomassie blue staining of purified UBE2T protein (Cat# TP300748). The protein was produced from HEK293T cells transfected with UBE2T cDNA clone (Cat# RC200748) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200748 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MQRASRLKRELHMLATEPPPGITCWQDKDQMDDLRAQILGGANTPYEKGVFKLEVIIPERYPFEPPQIRF
  LTPIYHPNIDSAGRICLDVLKLPPKGAWRPSLNIATVLTSIQLLMSEPNPDDPLMADISSEFKYNKPAFL
  KNARQWTEKHARQKQKADEEEMLDNLPEAGDSRVHNSTQKRKASQLVGIEKKFHPDV
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054895
• Locus ID: 29089
• UniProt ID: Q9NPD8, A0A024R9A9
• Cytogenetics: 1q32.1
• Refseq Size: 935
• Refseq ORF: 591
• Synonyms: FANCT; HSPC150; PIG50
• Summary: The protein encoded by this gene catalyzes the covalent attachment of ubiquitin to protein substrates. Defects in this gene have been associated with Fanconi anemia of complementation group T. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015]
• Protein Families: Druggable Genome