HIC5 (TGFB1I1) (NM_015927) Human Mass Spec Standard

CAT#: PH300761

TGFB1I1 MS Standard C13 and N15-labeled recombinant protein (NP_057011)

Product Images

Coomassie blue staining of purified TGFB1I1 protein (Cat# TP300761). The protein was produced from HEK293T cells transfected with TGFB1I1 cDNA clone (Cat# RC200761) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200761
• Predicted MW: 47.9 kDa
• Protein Sequence:
  Sequence Link

  >RC200761 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG
  TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE
  LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL
  CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK
  MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP
  DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP
  LTKGSFQERAGKPYCQPCFLKLFG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_057011
• RefSeq Size: 1812
• RefSeq ORF: 1332
• Synonyms: ARA55; HIC-5; HIC5; TSC-5
• Locus ID: 7041
• UniProt ID: O43294, A0A024QZE7
• Cytogenetics: 16p11.2
• Summary: 'This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]'
• Protein Families: Druggable Genome, Transcription Factors