HIC5 (TGFB1I1) (NM_001164719) Human Recombinant Protein
CAT#: TP328899
Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3.
View other "TGFB1I1" proteins (6)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC228899 protein sequence
Red=Cloning site Green=Tags(s) MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP LTKGSFQERAGKPYCQPCFLKLFG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 47.8 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | NULL or Add: Recombinant proteins was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_001158191 |
Locus ID | 7041 |
UniProt ID | O43294, A0A024QZE7 |
Cytogenetics | 16p11.2 |
Refseq Size | 1782 |
Refseq ORF | 1332 |
Synonyms | ARA55; HIC-5; HIC5; TSC-5 |
Summary | This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009] |
Protein Families | Druggable Genome, Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402475 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC431927 | TGFB1I1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY402475 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2 |
USD 396.00 |
|
LY431927 | Transient overexpression lysate of transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 3 |
USD 396.00 |
|
PH300761 | TGFB1I1 MS Standard C13 and N15-labeled recombinant protein (NP_057011) |
USD 2,055.00 |
|
TP300761 | Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review