HIC5 (TGFB1I1) (NM_015927) Human Recombinant Protein

CAT#: TP300761

Recombinant protein of human transforming growth factor beta 1 induced transcript 1 (TGFB1I1), transcript variant 2

Product Images

Coomassie blue staining of purified TGFB1I1 protein (Cat# TP300761). The protein was produced from HEK293T cells transfected with TGFB1I1 cDNA clone (Cat# RC200761) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200761 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MPRSGAPKERPAEPLTPPPSYGHQPQTGSGESSGASGDKDHLYSTVCKPRSPKPAAPAAPPFSSSSGVLG
  TGLCELDRLLQELNATQFNITDEIMSQFPSSKVASGEQKEDQSEDKKRPSLPSSPSPGLPKASATSATLE
  LDRLMASLSDFRVQNHLPASGPTQPPVVSSTNEGSPSPPEPTGKGSLDTMLGLLQSDLSRRGVPTQAKGL
  CGSCNKPIAGQVVTALGRAWHPEHFVCGGCSTALGGSSFFEKDGAPFCPECYFERFSPRCGFCNQPIRHK
  MVTALGTHWHPEHFCCVSCGEPFGDEGFHEREGRPYCRRDFLQLFAPRCQGCQGPILDNYISALSALWHP
  DCFVCRECFAPFSGGSFFEHEGRPLCENHFHARRGSLCATCGLPVTGRCVSALGRRFHPDHFTCTFCLRP
  LTKGSFQERAGKPYCQPCFLKLFG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 47.8 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_057011
• Locus ID: 7041
• UniProt ID: O43294, A0A024QZE7
• Cytogenetics: 16p11.2
• Refseq Size: 1812
• Refseq ORF: 1332
• Synonyms: ARA55; HIC-5; HIC5; TSC-5
• Summary: This gene encodes a coactivator of the androgen receptor, a transcription factor which is activated by androgen and has a key role in male sexual differentiation. The encoded protein is thought to regulate androgen receptor activity and may have a role to play in the treatment of prostate cancer. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2009]
• Protein Families: Druggable Genome, Transcription Factors