Cytochrome C Oxidase subunit VIb (COX6B1) (NM_001863) Human Mass Spec Standard

CAT#: PH300957

COX6B1 MS Standard C13 and N15-labeled recombinant protein (NP_001854)

Product Images

Coomassie blue staining of purified COX6B1 protein (Cat# TP300957). The protein was produced from HEK293T cells transfected with COX6B1 cDNA clone (Cat# RC200957) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC200957
• Predicted MW: 10.2 kDa
• Protein Sequence:
  Sequence Link

  >RC200957 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV
  TDWDEQRAEGTFPGKI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001854
• RefSeq Size: 590
• RefSeq ORF: 258
• Synonyms: COX6B; COXG; COXVIb1
• Locus ID: 1340
• UniProt ID: P14854
• Cytogenetics: 19q13.12
• Summary: 'Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010]'
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease