Cytochrome C Oxidase subunit VIb (COX6B1) (NM_001863) Human Recombinant Protein

CAT#: TP300957

Recombinant protein of human cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous) (COX6B1), nuclear gene encoding mitochondrial protein

Product Images

Coomassie blue staining of purified COX6B1 protein (Cat# TP300957). The protein was produced from HEK293T cells transfected with COX6B1 cDNA clone (Cat# RC200957) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC200957 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWV
  TDWDEQRAEGTFPGKI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 10 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001854
• Locus ID: 1340
• UniProt ID: P14854
• Cytogenetics: 19q13.12
• Refseq Size: 590
• Refseq ORF: 258
• Synonyms: COX6B; COXG; COXVIb1; MC4DN7
• Summary: Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010]
• Protein Pathways: Alzheimer's disease, Cardiac muscle contraction, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease