Zyxin (ZYX) (NM_001010972) Human Mass Spec Standard
CAT#: PH300960
ZYX MS Standard C13 and N15-labeled recombinant protein (NP_001010972)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC200960 |
Predicted MW | 61.3 kDa |
Protein Sequence |
>RC200960 representing NM_001010972
Red=Cloning site Green=Tags(s) MAAPRPSPAISVSVSAPAFYAPQKKFGPVVAPKPKVNPFRPGDSEPPPAPGAQRAQMGRVGEIPPPPPED FPLPPPPLAGDGDDAEGALGGAFPPPPPPIEESFPPAPLEEEIFPSPPPPPEEEGGPEAPIPPPPQPREK VSSIDLEIDSLSSLLDDMTKNDPFKARVSSGYVPPPVATPFSSKSSTKPAAGGTAPLPPWKSPSSSQPLP QVPAPAQSQTQFHVQPQPQPKPQVQLHVQSQTQPVSLANTQPRGPPASSPAPAPKFSPVTPKFTPVASKF SPGAPGGSGSQPNQKLGHPEALSAGTGSPQPPSFTYAQQREKPRVQEKQHPVPPPAQNQNQVRSPGAPGP LTLKEVEELEQLTQQLMQDMEHPQRQNVAVNELCGRCHQPLARAQPAVRALGQLFHIACFTCHQCAQQLQ GQQFYSLEGAPYCEGCYTDTLEKCNTCGEPITDRMLRATGKAYHPHCFTCVVCARPLEGTSFIVDQANRP HCVPDYHKQYAPRCSVCSEPIMPEPGRDETVRVVALDKNFHMKCYKCEDCGKPLSIEADDNGCFPLDGHV LCRKCHTARAQT myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001010972 |
RefSeq Size | 2322 |
RefSeq ORF | 1716 |
Synonyms | ESP-2; HED-2 |
Locus ID | 7791 |
UniProt ID | Q15942, Q96AF9 |
Cytogenetics | 7q34 |
Summary | Focal adhesions are actin-rich structures that enable cells to adhere to the extracellular matrix and at which protein complexes involved in signal transduction assemble. Zyxin is a zinc-binding phosphoprotein that concentrates at focal adhesions and along the actin cytoskeleton. Zyxin has an N-terminal proline-rich domain and three LIM domains in its C-terminal half. The proline-rich domain may interact with SH3 domains of proteins involved in signal transduction pathways while the LIM domains are likely involved in protein-protein binding. Zyxin may function as a messenger in the signal transduction pathway that mediates adhesion-stimulated changes in gene expression and may modulate the cytoskeletal organization of actin bundles. Alternative splicing results in multiple transcript variants that encode the same isoform. [provided by RefSeq, Jul 2008] |
Protein Pathways | Focal adhesion |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418663 | ZYX HEK293T cell transient overexpression lysate (as WB positive control) |
USD 187.00 |
|
LY418663 | Transient overexpression lysate of zyxin (ZYX), transcript variant 1 |
USD 605.00 |
|
PH314079 | ZYX MS Standard C13 and N15-labeled recombinant protein (NP_003452) |
USD 2,055.00 |
|
TP300960 | Recombinant protein of human zyxin (ZYX), transcript variant 2 |
USD 867.00 |
|
TP314079 | Recombinant protein of human zyxin (ZYX), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review