FAM3C (NM_014888) Human Mass Spec Standard

CAT#: PH301036

FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_055703)

Product Images

Coomassie blue staining of purified FAM3C protein (Cat# TP301036). The protein was produced from HEK293T cells transfected with FAM3C cDNA clone (Cat# RC201036) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201036
• Predicted MW: 24.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201036 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFA
  FKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQ
  DGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYE
  GWPEVVEMEGCIPQKQD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_055703
• RefSeq Size: 2552
• RefSeq ORF: 681
• Synonyms: GS3786; ILEI
• Locus ID: 10447
• UniProt ID: Q92520
• Cytogenetics: 7q31.31
• Summary: This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010]
• Protein Families: Secreted Protein, Transmembrane