FAM3C (NM_014888) Human Recombinant Protein
CAT#: TP720641
Purified recombinant protein of Human family with sequence similarity 3, member C (FAM3C), transcript variant 1
Product Images
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence |
QVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFAFKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQDGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYEGWPEVVEMEGCIPQKQDVDHHHHHH
|
Tag | C-His |
Predicted MW | 23.2 kDa |
Concentration | Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Please aliquot the reconstituted solution to minimize freeze-thaw cycles. |
Purity | >95% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | Lyophilized from a 0.2 µM filtered solution of 20mM PB, 150mM NaCl, pH 7.2 |
Endotoxin | Endotoxin level is < 0.1 ng/µg of protein (< 1 EU/µg) |
Storage | Store at -80°C. |
Stability | Stable for at least 6 months from date of receipt under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_055703 |
Locus ID | 10447 |
UniProt ID | Q92520 |
Cytogenetics | 7q31.31 |
Refseq Size | 2552 |
Refseq ORF | 681 |
Synonyms | GS3786; ILEI |
Summary | This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010] |
Protein Families | Secreted Protein, Transmembrane |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC414959 | FAM3C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC421876 | FAM3C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC425670 | FAM3C HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY414959 | Transient overexpression lysate of family with sequence similarity 3, member C (FAM3C), transcript variant 1 |
USD 325.00 |
|
LY421876 | Transient overexpression lysate of family with sequence similarity 3, member C (FAM3C), transcript variant 2 |
USD 325.00 |
|
LY425670 | Transient overexpression lysate of family with sequence similarity 3, member C (FAM3C), transcript variant 2 |
USD 325.00 |
|
PH301036 | FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_055703) |
USD 2,055.00 |
|
PH318912 | FAM3C MS Standard C13 and N15-labeled recombinant protein (NP_001035109) |
USD 2,055.00 |
|
TP301036 | Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 1 |
USD 439.00 |
|
TP318912 | Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review