FAM3C (NM_014888) Human Recombinant Protein

CAT#: TP301036

Recombinant protein of human family with sequence similarity 3, member C (FAM3C), transcript variant 1

Product Images

Coomassie blue staining of purified FAM3C protein (Cat# TP301036). The protein was produced from HEK293T cells transfected with FAM3C cDNA clone (Cat# RC201036) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201036 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MRVAGAAKLVVAVAVFLLTFYVISQVFEIKMDASLGNLFARSALDTAARSTKPPRYKCGISKACPEKHFA
  FKMASGAANVVGPKICLEDNVLMSGVKNNVGRGINVALANGKTGEVLDTKYFDMWGGDVAPFIEFLKAIQ
  DGTIVLMGTYDDGATKLNDEARRLIADLGSTSITNLGFRDNWVFCGGKGIKTKSPFEQHIKNNKDTNKYE
  GWPEVVEMEGCIPQKQD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 22.1 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_055703
• Locus ID: 10447
• UniProt ID: Q92520
• Cytogenetics: 7q31.31
• Refseq Size: 2552
• Refseq ORF: 681
• Synonyms: GS3786; ILEI
• Summary: This gene is a member of the family with sequence similarity 3 (FAM3) family and encodes a secreted protein with a GG domain. A change in expression of this protein has been noted in pancreatic cancer-derived cells. [provided by RefSeq, Mar 2010]
• Protein Families: Secreted Protein, Transmembrane