Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Mass Spec Standard

CAT#: PH301211

SUPT4H1 MS Standard C13 and N15-labeled recombinant protein (NP_003159)

Product Images

Coomassie blue staining of purified SUPT4H1 protein (Cat# TP301211). The protein was produced from HEK293T cells transfected with SUPT4H1 cDNA clone (Cat# RC201211) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201211
• Predicted MW: 13.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201211 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW
  VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003159
• RefSeq Size: 1545
• RefSeq ORF: 351
• Synonyms: SPT4; SPT4H; Supt4a; SUPT4H
• Locus ID: 6827
• UniProt ID: P63272
• Cytogenetics: 17q22
• Summary: 'This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012]'
• Protein Families: Transcription Factors