Suppressor of Ty 4 homolog 1 (SUPT4H1) (NM_003168) Human Recombinant Protein
CAT#: TP301211
Recombinant protein of human suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201211 protein sequence
Red=Cloning site Green=Tags(s) MALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSW VSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 13 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003159 |
Locus ID | 6827 |
UniProt ID | P63272 |
Cytogenetics | 17q22 |
Refseq Size | 1545 |
Refseq ORF | 351 |
Synonyms | SPT4; SPT4H; Supt4a; SUPT4H |
Summary | This gene encodes the small subunit of DRB (5,6-dichloro-1-beta-d-ribofuranosylbenzimidazole) sensitivity-inducing factor (DSIF) complex, which regulates mRNA processing and transcription elongation by RNA polymerase II. The encoded protein is localized to the nucleus and interacts with the large subunit (SUPT5H) to form the DSIF complex. Related pseudogenes have been identified on chromosomes 2 and 12. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Nov 2012] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418857 | SUPT4H1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY418857 | Transient overexpression lysate of suppressor of Ty 4 homolog 1 (S. cerevisiae) (SUPT4H1) |
USD 396.00 |
|
PH301211 | SUPT4H1 MS Standard C13 and N15-labeled recombinant protein (NP_003159) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review