Breast cancer suppressor candidate 1 (VWA5A) (NM_198315) Human Mass Spec Standard

CAT#: PH301474

VWA5A MS Standard C13 and N15-labeled recombinant protein (NP_938057)

Product Images

Coomassie blue staining of purified VWA5A protein (Cat# TP301474). The protein was produced from HEK293T cells transfected with VWA5A cDNA clone (Cat# RC201474) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201474
• Predicted MW: 45.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201474 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG
  KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA
  LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED
  KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG
  EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM
  EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_938057
• RefSeq Size: 1874
• RefSeq ORF: 1245
• Synonyms: BCSC-1; BCSC1; LOH11CR2A
• Locus ID: 4013
• UniProt ID: O00534
• Cytogenetics: 11q24.2
• Summary: ''