Breast cancer suppressor candidate 1 (VWA5A) (NM_198315) Human Recombinant Protein

CAT#: TP301474

Recombinant protein of human von Willebrand factor A domain containing 5A (VWA5A), transcript variant 2

Product Images

Coomassie blue staining of purified VWA5A protein (Cat# TP301474). The protein was produced from HEK293T cells transfected with VWA5A cDNA clone (Cat# RC201474) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201474 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVHFCGLLTLHREPVPLKSISVSVNIYEFVAGVSATLNYENEEKVPLEAFFVFPMDEDSAVYSFEALVDG
  KKIVAELQDKMKARTNYEKAISQGHQAFLLEGDSSSRDVFSCNVGNLQPGSKAAVTLKYVQELPLEADGA
  LRFVLPAVLNPRYQFSGSSKDSCLNVKTPIVPVEDLPYTLSMVATIDSQHGIEKVQSNCPLSPTEYLGED
  KTSAQVSLAAGHKFDRDVELLIYYNEVHTPSVVLEMGMPNMKPGHLMGDPSAMVSFYPNIPEDQPSNTCG
  EFIFLMDRSGSMQSPMSSQDTSQLRIQAAKETLILLLKSLPIGCYFNIYGFGSSYEACFPESVKYTQQTM
  EEALGRVKLMQADLGGTEILAPLQNIYRGPSIPGHPLQLFVFTDGEVTDTFSVIKEVRINRQKHR
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_938057
• Locus ID: 4013
• UniProt ID: O00534
• Cytogenetics: 11q24.2
• Refseq Size: 1874
• Refseq ORF: 1245
• Synonyms: BCSC-1; BCSC1; LOH11CR2A
• Summary: May play a role in tumorigenesis as a tumor suppressor. Altered expression of this protein and disruption of the molecular pathway it is involved in, may contribute directly to or modify tumorigenesis.[UniProtKB/Swiss-Prot Function]