GAS41 (YEATS4) (NM_006530) Human Mass Spec Standard

CAT#: PH301526

YEATS4 MS Standard C13 and N15-labeled recombinant protein (NP_006521)

Product Images

Coomassie blue staining of purified YEATS4 protein (Cat# TP301526). The protein was produced from HEK293T cells transfected with YEATS4 cDNA clone (Cat# RC201526) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201526
• Predicted MW: 26.5 kDa
• Protein Sequence:
  Sequence Link

  >RC201526 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL
  HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD
  EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC
  LKNEIRKLEEDDQAKDI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006521
• RefSeq Size: 1509
• RefSeq ORF: 681
• Synonyms: 4930573H17Rik; B230215M10Rik; GAS41; NUBI-1; YAF9
• Locus ID: 8089
• UniProt ID: O95619
• Cytogenetics: 12q15
• Summary: The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome, Transcription Factors