GAS41 (YEATS4) (NM_006530) Human Recombinant Protein

CAT#: TP301526

Purified recombinant protein of Homo sapiens YEATS domain containing 4 (YEATS4)

Product Images

Coomassie blue staining of purified YEATS4 protein (Cat# TP301526). The protein was produced from HEK293T cells transfected with YEATS4 cDNA clone (Cat# RC201526) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201526 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKL
  HESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYD
  EMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINC
  LKNEIRKLEEDDQAKDI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 26.3 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_006521
• Locus ID: 8089
• UniProt ID: O95619
• Cytogenetics: 12q15
• Refseq Size: 1509
• Refseq ORF: 681
• Synonyms: 4930573H17Rik; B230215M10Rik; GAS41; NUBI-1; YAF9
• Summary: The protein encoded by this gene is found in the nucleoli. It has high sequence homology to human MLLT1, and yeast and human MLLT3 proteins. Both MLLT1 and MLLT3 proteins belong to a class of transcription factors, indicating that the encoded protein might also represent a transcription factor. This protein is thought to be required for RNA transcription. This gene has been shown to be amplified in tumors. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2014]
• Protein Families: Druggable Genome, Transcription Factors