CHMP2B (NM_014043) Human Mass Spec Standard

CAT#: PH301532

CHMP2B MS Standard C13 and N15-labeled recombinant protein (NP_054762)

Product Images

Coomassie blue staining of purified CHMP2B protein (Cat# TP301532). The protein was produced from HEK293T cells transfected with CHMP2B cDNA clone (Cat# RC201532) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201532
• Predicted MW: 23.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201532 representing NM_014043
  Red=Cloning site Green=Tags(s)
  
  MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRK
  QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
  MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL
  GVD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054762
• RefSeq Size: 2410
• RefSeq ORF: 639
• Synonyms: ALS17; CHMP2.5; DMT1; VPS2-2; VPS2B
• Locus ID: 25978
• UniProt ID: Q9UQN3, B2RE76
• Cytogenetics: 3p11.2
• Summary: This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008]
• Protein Pathways: Endocytosis