CHMP2B (NM_014043) Human Recombinant Protein

CAT#: TP301532

Recombinant protein of human chromatin modifying protein 2B (CHMP2B)

Product Images

Coomassie blue staining of purified CHMP2B protein (Cat# TP301532). The protein was produced from HEK293T cells transfected with CHMP2B cDNA clone (Cat# RC201532) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201532 representing NM_014043
  Red=Cloning site Green=Tags(s)
  
  MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRK
  QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE
  MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL
  GVD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 23.7 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_054762
• Locus ID: 25978
• UniProt ID: Q9UQN3, B2RE76
• Cytogenetics: 3p11.2
• Refseq Size: 2410
• Refseq ORF: 639
• Synonyms: ALS17; CHMP2.5; DMT1; FTDALS7; VPS2-2; VPS2B
• Summary: This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008]
• Protein Pathways: Endocytosis