CHMP2B (NM_014043) Human Recombinant Protein
CAT#: TP301532
Recombinant protein of human chromatin modifying protein 2B (CHMP2B)
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201532 representing NM_014043
Red=Cloning site Green=Tags(s) MASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAKIGNKEACKVLAKQLVHLRK QKTRTFAVSSKVTSMSTQTKVMNSQMKMAGAMSTTAKTMQAVNKKMDPQKTLQTMQNFQKENMKMEMTEE MINDTLDDIFDGSDDEEESQDIVNQVLDEIGIEISGKMAKAPSAARSLPSASTSKATISDEEIERQLKAL GVD myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.7 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_054762 |
| Locus ID | 25978 |
| UniProt ID | Q9UQN3, B2RE76 |
| Cytogenetics | 3p11.2 |
| Refseq Size | 2410 |
| Refseq ORF | 639 |
| Synonyms | ALS17; CHMP2.5; DMT1; FTDALS7; VPS2-2; VPS2B |
| Summary | This gene encodes a component of the heteromeric ESCRT-III complex (Endosomal Sorting Complex Required for Transport III) that functions in the recycling or degradation of cell surface receptors. ESCRT-III functions in the concentration and invagination of ubiquitinated endosomal cargos into intralumenal vesicles. The protein encoded by this gene is found as a monomer in the cytosol or as an oligomer in ESCRT-III complexes on endosomal membranes. It is expressed in neurons of all major regions of the brain. Mutations in this gene result in one form of familial frontotemporal lobar degeneration. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Endocytosis |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415517 | CHMP2B HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY415517 | Transient overexpression lysate of chromatin modifying protein 2B (CHMP2B) |
USD 436.00 |
|
| PH301532 | CHMP2B MS Standard C13 and N15-labeled recombinant protein (NP_054762) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China