PRP18 homolog (PRPF18) (NM_003675) Human Mass Spec Standard

CAT#: PH301556

PRPF18 MS Standard C13 and N15-labeled recombinant protein (NP_003666)

Product Images

Coomassie blue staining of purified PRPF18 protein (Cat# TP301556). The protein was produced from HEK293T cells transfected with PRPF18 cDNA clone (Cat# RC201556) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201556
• Predicted MW: 39.9 kDa
• Protein Sequence:
  Sequence Link

  >RC201556 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLTSSNPVLELEL
  AEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLN
  EIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYV
  KRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWP
  IGVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003666
• RefSeq Size: 1711
• RefSeq ORF: 1026
• Synonyms: hPrp18; PRP18
• Locus ID: 8559
• UniProt ID: Q99633
• Cytogenetics: 10p13
• Summary: Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to the yeast splicing factor Prp18. [provided by RefSeq, Jul 2008]
• Protein Pathways: Spliceosome