PRP18 homolog (PRPF18) (NM_003675) Human Recombinant Protein
CAT#: TP301556
Recombinant protein of human PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18)
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201556 protein sequence
Red=Cloning site Green=Tags(s) MDILKSEILRKRQLVEDRNLLVENKKYFKRSELAKKEEEAYFERCGYKIQPKEEDQKPLTSSNPVLELEL AEEKLPMTLSRQEVIRRLRERGEPIRLFGETDYDAFQRLRKIEILTPEVNKGLRNDLKAALDKIDQQYLN EIVGGQEPGEEDTQNDLKVHEENTTIEELEALGESLGKGDDHKDMDIITKFLKFLLGVWAKELNAREDYV KRSVQGKLNSATQKQTESYLRPLFRKLRKRNLPADIKESITDIIKFMLQREYVKANDAYLQMAIGNAPWP IGVTMVGIHARTGREKIFSKHVAHVLNDETQRKYIQGLKRLMTICQKHFPTDPSKCVEYNAL myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 39.7 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_003666 |
Locus ID | 8559 |
UniProt ID | Q99633 |
Cytogenetics | 10p13 |
Refseq Size | 1711 |
Refseq ORF | 1026 |
Synonyms | hPrp18; PRP18 |
Summary | Pre-mRNA splicing occurs in 2 sequential transesterification steps. The protein encoded by this gene is found to be essential for the catalytic step II in pre-mRNA splicing process. It is found in the spliceosome, and contains seven WD repeats, which function in protein-protein interactions. This protein has a sequence similarity to the yeast splicing factor Prp18. [provided by RefSeq, Jul 2008] |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418505 | PRPF18 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY418505 | Transient overexpression lysate of PRP18 pre-mRNA processing factor 18 homolog (S. cerevisiae) (PRPF18) |
USD 325.00 |
|
PH301556 | PRPF18 MS Standard C13 and N15-labeled recombinant protein (NP_003666) |
USD 2,055.00 |
{0} Product Review(s)
Be the first one to submit a review