L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Mass Spec Standard

CAT#: PH301559

KYNU MS Standard C13 and N15-labeled recombinant protein (NP_001028170)

Product Images

Coomassie blue staining of purified KYNU protein (Cat# TP301559). The protein was produced from HEK293T cells transfected with KYNU cDNA clone (Cat# RC201559) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201559
• Predicted MW: 34.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201559 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY
  FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN
  LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK
  EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA
  GAGGIAGAFIHEKHAHTIKPARSEFFN
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001028170
• RefSeq Size: 1315
• RefSeq ORF: 921
• Synonyms: KYNUU; VCRL2
• Locus ID: 8942
• UniProt ID: Q16719
• Cytogenetics: 2q22.2
• Summary: Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
• Protein Families: Protease
• Protein Pathways: Metabolic pathways, Tryptophan metabolism