L Kynurenine Hydrolase (KYNU) (NM_001032998) Human Recombinant Protein

CAT#: TP301559

Recombinant protein of human kynureninase (L-kynurenine hydrolase) (KYNU), transcript variant 2

Product Images

Coomassie blue staining of purified KYNU protein (Cat# TP301559). The protein was produced from HEK293T cells transfected with KYNU cDNA clone (Cat# RC201559) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201559 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEPSSLELPADTVQRIAAELKCHPTDERVALHLDEEDKLRHFRECFYIPKIQDLPPVDLSLVNKDENAIY
  FLGNSLGLQPKMVKTYLEEELDKWAKIAAYGHEVGKRPWITGDESIVGLMKDIVGANEKEIALMNALTVN
  LHLLMLSFFKPTPKRYKILLEAKAFPSDHYAIESQLQLHGLNIEESMRMIKPREGEETLRIEDILEVIEK
  EGDSIAVILFSGVHFYTGQHFNIPAITKAGQAKGCYVGFDLAHAVGNVELYLHDWGVDFACWCSYKYLNA
  GAGGIAGAFIHEKHAHTIKPARSEFFN
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 34.5 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001028170
• Locus ID: 8942
• UniProt ID: Q16719
• Cytogenetics: 2q22.2
• Refseq Size: 1315
• Refseq ORF: 921
• Synonyms: KYNUU; VCRL2
• Summary: Kynureninase is a pyridoxal-5'-phosphate (pyridoxal-P) dependent enzyme that catalyzes the cleavage of L-kynurenine and L-3-hydroxykynurenine into anthranilic and 3-hydroxyanthranilic acids, respectively. Kynureninase is involved in the biosynthesis of NAD cofactors from tryptophan through the kynurenine pathway. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]
• Protein Families: Protease
• Protein Pathways: Metabolic pathways, Tryptophan metabolism