SUGT1 (NM_006704) Human Mass Spec Standard

CAT#: PH301676

SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_006695)

Product Images

Coomassie blue staining of purified SUGT1 protein (Cat# TP301676). The protein was produced from HEK293T cells transfected with SUGT1 cDNA clone (Cat# RC201676) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201676
• Predicted MW: 37.8 kDa
• Protein Sequence:
  Sequence Link

  >RC201676 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK
  SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKI
  KYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKI
  EIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRL
  FQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_006695
• RefSeq Size: 1705
• RefSeq ORF: 999
• Synonyms: SGT1
• Locus ID: 10910
• UniProt ID: Q9Y2Z0, A8K7W3
• Cytogenetics: 13q14.3
• Summary: This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. [provided by RefSeq, Mar 2016]
• Protein Pathways: NOD-like receptor signaling pathway