SUGT1 (NM_006704) Human Recombinant Protein
CAT#: TP301676
Recombinant protein of human SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2
USD 379.00
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201676 protein sequence
Red=Cloning site Green=Tags(s) MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDSADANFSVWIKRCQEAQNGSESEVWTHQSKI KYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALVKLPSGEDYNLKLELLHPIIPEQSTFKVLSTKI EIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSSSPYTRNWDKLVGEIKEEEKNEKLEGDAALNRL FQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKRKVEINPPDDMEWKKY myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 37.6 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_006695 |
Locus ID | 10910 |
UniProt ID | Q9Y2Z0, A8K7W3 |
Cytogenetics | 13q14.3 |
Refseq Size | 1705 |
Refseq ORF | 999 |
Synonyms | SGT1 |
Summary | This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. [provided by RefSeq, Mar 2016] |
Protein Pathways | NOD-like receptor signaling pathway |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416475 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC427302 | SUGT1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY416475 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 2 |
USD 396.00 |
|
LY427302 | Transient overexpression lysate of SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1 |
USD 396.00 |
|
PH301676 | SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_006695) |
USD 2,055.00 |
|
PH325548 | SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_001124384) |
USD 2,055.00 |
|
TP325548 | Purified recombinant protein of Homo sapiens SGT1, suppressor of G2 allele of SKP1 (S. cerevisiae) (SUGT1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review