SUGT1 (NM_001130912) Human Mass Spec Standard

CAT#: PH325548

SUGT1 MS Standard C13 and N15-labeled recombinant protein (NP_001124384)

Product Images

Coomassie blue staining of purified SUGT1 protein (Cat# TP325548). The protein was produced from HEK293T cells transfected with SUGT1 cDNA clone (Cat# RC225548) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC225548
• Predicted MW: 40.8 kDa
• Protein Sequence:
  Sequence Link

  >RC225548 representing NM_001130912
  Red=Cloning site Green=Tags(s)
  
  MAAAAAGTATSQRFFQSFSDALIDEDPQAALEELTKALEQKPDDAQYYCQRAYCHILLGNYCVAVADAKK
  SLELNPNNSTAMLRKGICEYHEKNYAAALETFTEGQKLDIETGFHRVGQAGLQLLTSSDPPALDSQSAGI
  TGADANFSVWIKRCQEAQNGSESEVWTHQSKIKYDWYQTESQVVITLMIKNVQKNDVNVEFSEKELSALV
  KLPSGEDYNLKLELLHPIIPEQSTFKVLSTKIEIKLKKPEAVRWEKLEGQGDVPTPKQFVADVKNLYPSS
  SPYTRNWDKLVGEIKEEEKNEKLEGDAALNRLFQQIYSDGSDEVKRAMNKSFMESGGTVLSTNWSDVGKR
  KVEINPPDDMEWKKY
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001124384
• RefSeq ORF: 1095
• Synonyms: SGT1
• Locus ID: 10910
• UniProt ID: Q9Y2Z0, A8K7W3
• Cytogenetics: 13q14.3
• Summary: This gene encodes a highly conserved nuclear protein involved in kinetochore function and required for the G1/S and G2/M transitions. This protein interacts with heat shock protein 90. Alternative splicing results in multiple transcript variants. Pseudogenes for this gene have been defined on several different chromosomes. [provided by RefSeq, Mar 2016]
• Protein Pathways: NOD-like receptor signaling pathway