XTP3TPA (DCTPP1) (NM_024096) Human Mass Spec Standard

CAT#: PH301727

DCTPP1 MS Standard C13 and N15-labeled recombinant protein (NP_077001)

Product Images

Coomassie blue staining of purified DCTPP1 protein (Cat# TP301727). The protein was produced from HEK293T cells transfected with DCTPP1 cDNA clone (Cat# RC201727) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201727
• Predicted MW: 18.7 kDa
• Protein Sequence:
  Sequence Link

  >RC201727 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MSVAGGEIRGDTGGEDTAAPGRFSFSPEPTLEDIRRLHAEFAAERDWEQFHQPRNLLLALVGEVGELAEL
  FQWKTDGEPGPQGWSPRERAALQEELSDVLIYLVALAARCRVDLPLAVLSKMDINRRRYPAHLARSSSRK
  YTELPHGAISEDQAVGPADIPCDSTGQTST
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_077001
• RefSeq Size: 1143
• RefSeq ORF: 510
• Synonyms: CDA03; RS21C6; XTP3TPA
• Locus ID: 79077
• UniProt ID: Q9H773
• Cytogenetics: 16p11.2
• Summary: The protein encoded by this gene is dCTP pyrophosphatase, which converts dCTP to dCMP and inorganic pyrophosphate. The encoded protein also displays weak activity against dTTP and dATP, but none against dGTP. This protein may be responsible for eliminating excess dCTP after DNA synthesis and may prevent overmethylation of CpG islands. Three transcript variants, one protein-coding and the other two non-protein coding, have been found for this gene. [provided by RefSeq, Dec 2015]
• Protein Families: Stem cell - Pluripotency