SAE1 (NM_005500) Human Mass Spec Standard

CAT#: PH301820

SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491)

Product Images

Coomassie blue staining of purified SAE1 protein (Cat# TP301820). The protein was produced from HEK293T cells transfected with SAE1 cDNA clone (Cat# RC201820) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201820
• Predicted MW: 38.4 kDa
• Protein Sequence:
  Sequence Link

  >RC201820 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ
  VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV
  KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK
  VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL
  GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_005491
• RefSeq Size: 2538
• RefSeq ORF: 1038
• Synonyms: AOS1; HSPC140; SUA1; UBLE1A
• Locus ID: 10055
• UniProt ID: Q9UBE0, A0A024R0R4
• Cytogenetics: 19q13.32
• Summary: Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]). [supplied by OMIM, Mar 2010]
• Protein Pathways: Ubiquitin mediated proteolysis