SAE1 (NM_001145713) Human Mass Spec Standard
CAT#: PH326908
SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC226908 |
Predicted MW | 32.9 kDa |
Protein Sequence |
>RC226908 representing NM_001145713
Red=Cloning site Green=Tags(s) MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQGPVSAGPSSQQLLLLRWHEGEWDCGVPWPQVNSRFG SPRDANCSMPTCIPCPLPS myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_001139185 |
RefSeq ORF | 897 |
Synonyms | AOS1; HSPC140; SUA1; UBLE1A |
Locus ID | 10055 |
UniProt ID | Q9UBE0 |
Cytogenetics | 19q13.32 |
Summary | Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]). [supplied by OMIM, Mar 2010] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401688 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428977 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429497 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401688 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
USD 396.00 |
|
LY428977 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 |
USD 396.00 |
|
LY429497 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
USD 396.00 |
|
PH301820 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491) |
USD 2,055.00 |
|
PH327950 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) |
USD 2,055.00 |
|
TP301820 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
USD 823.00 |
|
TP326908 | Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 |
USD 748.00 |
|
TP327950 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review