SAE1 (NM_005500) Human Recombinant Protein
CAT#: TP301820
Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC201820 protein sequence
Red=Cloning site Green=Tags(s) MVEKEEAGGGISEEEAAQYDRQIRLWGLEAQKRLRASRVLLVGLKGLGAEIAKNLILAGVKGLTMLDHEQ VTPEDPGAQFLIRTGSVGRNRAEASLERAQNLNPMVDVKVDTEDIEKKPESFFTQFDAVCLTCCSRDVIV KVDQICHKNSIKFFTGDVFGYHGYTFANLGEHEFVEEKTKVAKVSQGVEDGPDTKRAKLDSSETTMVKKK VVFCPVKEALEVDWSSEKAKAALKRTTSDYFLLQVLLKFRTDKGRDPSSDTYEEDSELLLQIRNDVLDSL GISPDLLPEDFVRYCFSEMAPVCAVVGGILAQEIVKALSQRDPPHNNFFFFDGMKGNGIVECLGPK myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 38.3 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Bioactivity | ELISA capture for autoantibodies (PMID: 28298642) |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_005491 |
Locus ID | 10055 |
UniProt ID | Q9UBE0, A0A024R0R4 |
Cytogenetics | 19q13.32 |
Refseq Size | 2538 |
Refseq ORF | 1038 |
Synonyms | AOS1; HSPC140; SUA1; UBLE1A |
Summary | Posttranslational modification of proteins by the addition of the small protein SUMO (see SUMO1; MIM 601912), or sumoylation, regulates protein structure and intracellular localization. SAE1 and UBA2 (MIM 613295) form a heterodimer that functions as a SUMO-activating enzyme for the sumoylation of proteins (Okuma et al., 1999 [PubMed 9920803]).[supplied by OMIM, Mar 2010] |
Protein Pathways | Ubiquitin mediated proteolysis |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401688 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC428977 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429497 | SAE1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY401688 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
USD 396.00 |
|
LY428977 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 |
USD 396.00 |
|
LY429497 | Transient overexpression lysate of SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
USD 396.00 |
|
PH301820 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_005491) |
USD 2,055.00 |
|
PH326908 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_001139185) |
USD 2,055.00 |
|
PH327950 | SAE1 MS Standard C13 and N15-labeled recombinant protein (NP_057486) |
USD 2,055.00 |
|
TP326908 | Purified recombinant protein of Homo sapiens SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 2 |
USD 748.00 |
|
TP327950 | Recombinant protein of human SUMO1 activating enzyme subunit 1 (SAE1), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review