TMEM98 (NM_015544) Human Mass Spec Standard

CAT#: PH301829

TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_056359)

Product Images

Coomassie blue staining of purified TMEM98 protein (Cat# TP301829). The protein was produced from HEK293T cells transfected with TMEM98 cDNA clone (Cat# RC201829) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201829
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC201829 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT
  NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD
  DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD
  KGLPGPEGFLQEQSAI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_056359
• RefSeq Size: 1808
• RefSeq ORF: 678
• Synonyms: TADA1
• Locus ID: 26022
• UniProt ID: Q9Y2Y6
• Cytogenetics: 17q11.2
• Summary: This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014]
• Protein Families: Transmembrane