TMEM98 (NM_001033504) Human Mass Spec Standard
CAT#: PH313633
TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_001028676)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC213633 |
| Predicted MW | 24.6 kDa |
| Protein Sequence |
>RC213633 protein sequence
Red=Cloning site Green=Tags(s) METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD KGLPGPEGFLQEQSAI myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_001028676 |
| RefSeq Size | 1732 |
| RefSeq ORF | 678 |
| Synonyms | TADA1 |
| Locus ID | 26022 |
| UniProt ID | Q9Y2Y6 |
| Cytogenetics | 17q11.2 |
| Summary | This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014] |
| Protein Families | Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414489 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422371 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425557 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY414489 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 1 |
USD 436.00 |
|
| LY422371 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 2 |
USD 436.00 |
|
| LY425557 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 2 |
USD 396.00 |
|
| PH301829 | TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_056359) |
USD 2,055.00 |
|
| TP301829 | Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 1 |
USD 823.00 |
|
| TP313633 | Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China