TMEM98 (NM_001033504) Human Mass Spec Standard

CAT#: PH313633

TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_001028676)

Product Images

Coomassie blue staining of purified TMEM98 protein (Cat# TP313633). The protein was produced from HEK293T cells transfected with TMEM98 cDNA clone (Cat# RC213633) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC213633
• Predicted MW: 24.6 kDa
• Protein Sequence:
  Sequence Link

  >RC213633 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT
  NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD
  DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD
  KGLPGPEGFLQEQSAI
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_001028676
• RefSeq Size: 1732
• RefSeq ORF: 678
• Synonyms: TADA1
• Locus ID: 26022
• UniProt ID: Q9Y2Y6
• Cytogenetics: 17q11.2
• Summary: This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014]
• Protein Families: Transmembrane