TMEM98 (NM_015544) Human Recombinant Protein
CAT#: TP301829
Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 1
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201829 protein sequence
Red=Cloning site Green=Tags(s) METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD KGLPGPEGFLQEQSAI myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 24.4 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | Cell treatment (PMID: 25946230) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_056359 |
| Locus ID | 26022 |
| UniProt ID | Q9Y2Y6 |
| Cytogenetics | 17q11.2 |
| Refseq Size | 1808 |
| Refseq ORF | 678 |
| Synonyms | TADA1 |
| Summary | This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC414489 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC422371 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425557 | TMEM98 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY414489 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 1 |
USD 436.00 |
|
| LY422371 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 2 |
USD 436.00 |
|
| LY425557 | Transient overexpression lysate of transmembrane protein 98 (TMEM98), transcript variant 2 |
USD 396.00 |
|
| PH301829 | TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_056359) |
USD 2,055.00 |
|
| PH313633 | TMEM98 MS Standard C13 and N15-labeled recombinant protein (NP_001028676) |
USD 2,055.00 |
|
| TP313633 | Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China