TMEM98 (NM_015544) Human Recombinant Protein

CAT#: TP301829

Recombinant protein of human transmembrane protein 98 (TMEM98), transcript variant 1

Product Images

Coomassie blue staining of purified TMEM98 protein (Cat# TP301829). The protein was produced from HEK293T cells transfected with TMEM98 cDNA clone (Cat# RC201829) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201829 protein sequence
  Red=Cloning site Green=Tags(s)
  
  METVVIVAIGVLATIFLASFAALVLVCRQRYCRPRDLLQRYDSKPIVDLIGAMETQSEPSELELDDVVIT
  NPHIEAILENEDWIEDASGLMSHCIAILKICHTLTEKLVAMTMGSGAKMKTSASVSDIIVVAKRISPRVD
  DVVKSMYPPLDPKLLDARTTALLLSVSHLVLVTRNACHLTGGLDWIDQSLSAAEEHLEVLREAALASEPD
  KGLPGPEGFLQEQSAI
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.4 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Bioactivity: Cell treatment (PMID: 25946230)
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_056359
• Locus ID: 26022
• UniProt ID: Q9Y2Y6
• Cytogenetics: 17q11.2
• Refseq Size: 1808
• Refseq ORF: 678
• Synonyms: TADA1
• Summary: This gene encodes a transmembrane protein. A missense mutation in this gene result in Nanophthalmos 4 (NNO4). Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Sep 2014]
• Protein Families: Transmembrane