Asparagine synthetase (ASNS) (NM_183356) Human Mass Spec Standard
CAT#: PH301838
ASNS MS Standard C13 and N15-labeled recombinant protein (NP_899199)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201838 |
Predicted MW | 64.4 kDa |
Protein Sequence |
>RC201838 protein sequence
Red=Cloning site Green=Tags(s) MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDE PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK A myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_899199 |
RefSeq Size | 2362 |
RefSeq ORF | 1683 |
Synonyms | ASNSD; TS11 |
Locus ID | 440 |
UniProt ID | P08243 |
Cytogenetics | 7q21.3 |
Summary | 'The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010]' |
Protein Families | Druggable Genome |
Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC403336 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC405247 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC419813 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LC430656 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 99.00 |
|
LY403336 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 1 |
USD 325.00 |
|
LY405247 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 3 |
USD 325.00 |
|
LY419813 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 2 |
USD 325.00 |
|
LY430656 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 3 |
USD 325.00 |
|
PH301297 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_001664) |
USD 2,055.00 |
|
PH315380 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_597680) |
USD 2,055.00 |
|
TP301297 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 2 |
USD 823.00 |
|
TP301838 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 3 |
USD 823.00 |
|
TP315380 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review