Asparagine synthetase (ASNS) (NM_001673) Human Recombinant Protein
CAT#: TP301297
Recombinant protein of human asparagine synthetase (ASNS), transcript variant 2
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC201297 protein sequence
Red=Cloning site Green=Tags(s) MCGIWALFGSDDCLSVQCLSAMKIAHRGPDAFRFENVNGYTNCCFGFHRLAVVDPLFGMQPIRVKKYPYL WLCYNGEIYNHKKMQQHFEFEYQTKVDGEIILHLYDKGGIEQTICMLDGVFAFVLLDTANKKVFLGRDTY GVRPLFKAMTEDGFLAVCSEAKGLVTLKHSATPFLKVEPFLPGHYEVLDLKPNGKVASVEMVKYHHCRDV PLHALYDNVEKLFPGFEIETVKNNLRILFNNAVKKRLMTDRRIGCLLSGGLDSSLVAATLLKQLKEAQVQ YPLQTFAIGMEDSPDLLAARKVADHIGSEHYEVLFNSEEGIQALDEVIFSLETYDITTVRASVGMYLISK YIRKNTDSVVIFSGEGSDELTQGYIYFHKAPSPEKAEEESERLLRELYLFDVLRADRTTAAHGLELRVPF LDHRFSSYYLSLPPEMRIPKNGIEKHLLRETFEDSNLIPKEILWRPKEAFSDGITSVKNSWFKILQEYVE HQVDDAMMANAAQKFPFNTPKTKEGYYYRQVFERHYPGRADWLSHYWMPKWINATDPSARTLTHYKSAVK A myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 64.2 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_001664 |
| Locus ID | 440 |
| UniProt ID | P08243 |
| Cytogenetics | 7q21.3 |
| Refseq Size | 2084 |
| Refseq ORF | 1683 |
| Synonyms | ASNSD; TS11 |
| Summary | The protein encoded by this gene is involved in the synthesis of asparagine. This gene complements a mutation in the temperature-sensitive hamster mutant ts11, which blocks progression through the G1 phase of the cell cycle at nonpermissive temperature. Alternatively spliced transcript variants have been described for this gene. [provided by RefSeq, May 2010] |
| Protein Families | Druggable Genome |
| Protein Pathways | Alanine, aspartate and glutamate metabolism, Metabolic pathways, Nitrogen metabolism |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC403336 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC405247 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC419813 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC430656 | ASNS HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY403336 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 1 |
USD 436.00 |
|
| LY405247 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 3 |
USD 436.00 |
|
| LY419813 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 2 |
USD 436.00 |
|
| LY430656 | Transient overexpression lysate of asparagine synthetase (ASNS), transcript variant 3 |
USD 396.00 |
|
| PH301297 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_001664) |
USD 2,055.00 |
|
| PH301838 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_899199) |
USD 2,055.00 |
|
| PH315380 | ASNS MS Standard C13 and N15-labeled recombinant protein (NP_597680) |
USD 2,055.00 |
|
| TP301838 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 3 |
USD 823.00 |
|
| TP315380 | Recombinant protein of human asparagine synthetase (ASNS), transcript variant 1 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China