NAP1L1 (NM_139207) Human Mass Spec Standard
CAT#: PH301851
NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_631946)
Specifications
Product Data | |
Tag | C-Myc/DDK |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC201851 |
Predicted MW | 45.4 kDa |
Protein Sequence |
>RC201851 protein sequence
Red=Cloning site Green=Tags(s) MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | 50 ug/ml as determined by BCA |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
Reference Data | |
RefSeq | NP_631946 |
RefSeq Size | 4451 |
RefSeq ORF | 1173 |
Synonyms | NAP1; NAP1L; NRP |
Locus ID | 4673 |
UniProt ID | P55209, A0A024RBB7, Q9H2B0 |
Cytogenetics | 12q21.2 |
Summary | 'This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. [provided by RefSeq, Apr 2015]' |
Documents
FAQs |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408353 | NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC417929 | NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC430096 | NAP1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408353 | Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1 |
USD 396.00 |
|
LY417929 | Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2 |
USD 396.00 |
|
LY430096 | Transient overexpression lysate of nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1 |
USD 396.00 |
|
PH320821 | NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_004528) |
USD 2,055.00 |
|
TP301851 | Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1 |
USD 823.00 |
|
TP320821 | Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 2 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review