NAP1L1 (NM_139207) Human Recombinant Protein

CAT#: TP301851

Recombinant protein of human nucleosome assembly protein 1-like 1 (NAP1L1), transcript variant 1

Product Images

Coomassie blue staining of purified NAP1L1 protein (Cat# TP301851). The protein was produced from HEK293T cells transfected with NAP1L1 cDNA clone (Cat# RC201851) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC201851 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL
  PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED
  EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM
  SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK
  GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD
  DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 45.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_631946
• Locus ID: 4673
• UniProt ID: P55209, A0A024RBB7, Q9H2B0
• Cytogenetics: 12q21.2
• Refseq Size: 4451
• Refseq ORF: 1173
• Synonyms: NAP1; NAP1L; NRP
• Summary: This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. [provided by RefSeq, Apr 2015]