NAP1L1 (NM_004537) Human Mass Spec Standard

CAT#: PH320821

NAP1L1 MS Standard C13 and N15-labeled recombinant protein (NP_004528)

Product Images

Coomassie blue staining of purified NAP1L1 protein (Cat# TP320821). The protein was produced from HEK293T cells transfected with NAP1L1 cDNA clone (Cat# RC220821) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC220821
• Predicted MW: 45.2 kDa
• Protein Sequence:
  Sequence Link

  >RC220821 representing NM_004537
  Red=Cloning site Green=Tags(s)
  
  MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESL
  PRVVKRRVNALKNLQVKCAQIEAKFYEEVHDLERKYAVLYQPLFDKRFEIINAIYEPTEEECEWKPDEED
  EISEELKEKAKIEDEKKDEEKEDPKGIPEFWLTVFKNVDLLSDMVQEHDEPILKHLKDIKVKFSDAGQPM
  SFVLEFHFEPNEYFTNEVLTKTYRMRSEPDDSDPFSFDGPEIMGCTGCQIDWKKGKNVTLKTIKKKQKHK
  GRGTVRTVTKTVSNDSFFNFFAPPEVPESGDLDDDAEAILAADFEIGHFLRERIIPRSVLYFTGEAIEDD
  DDDYDEEGEEADEEGEEEGDEENDPDYDPKKDQNPAECKQQ
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_004528
• RefSeq Size: 2908
• RefSeq ORF: 1173
• Synonyms: NAP1; NAP1L; NRP
• Locus ID: 4673
• UniProt ID: P55209, A0A024RBB7, Q9H2B0
• Cytogenetics: 12q21.2
• Summary: 'This gene encodes a member of the nucleosome assembly protein (NAP) family. This protein participates in DNA replication and may play a role in modulating chromatin formation and contribute to the regulation of cell proliferation. Alternative splicing results in multiple transcript variants encoding different isoforms; however, not all have been fully described. [provided by RefSeq, Apr 2015]'