C20orf30 (TMEM230) (NM_014145) Human Mass Spec Standard

CAT#: PH301878

C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_054864)

Product Images

Coomassie blue staining of purified TMEM230 protein (Cat# TP301878). The protein was produced from HEK293T cells transfected with TMEM230 cDNA clone (Cat# RC201878) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC201878
• Predicted MW: 13.2 kDa
• Protein Sequence:
  Sequence Link

  >RC201878 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY
  ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_054864
• RefSeq Size: 1699
• RefSeq ORF: 360
• Synonyms: C20orf30; dJ1116H23.2.1; HSPC274
• Locus ID: 29058
• UniProt ID: Q96A57
• Cytogenetics: 20p13-p12.3
• Summary: This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017]
• Protein Families: Transmembrane