C20orf30 (TMEM230) (NM_014145) Human Mass Spec Standard
CAT#: PH301878
C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_054864)
Specifications
| Product Data | |
| Tag | C-Myc/DDK |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC201878 |
| Predicted MW | 13.2 kDa |
| Protein Sequence |
>RC201878 protein sequence
Red=Cloning site Green=Tags(s) MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD myc-FLAG tag |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | 50 ug/ml as determined by BCA |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Reference Data | |
| RefSeq | NP_054864 |
| RefSeq Size | 1699 |
| RefSeq ORF | 360 |
| Synonyms | C20orf30; dJ1116H23.2.1; HSPC274 |
| Locus ID | 29058 |
| UniProt ID | Q96A57 |
| Cytogenetics | 20p13-p12.3 |
| Summary | This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017] |
| Protein Families | Transmembrane |
Documents
| FAQs |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415474 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423152 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC423153 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425277 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC425278 | TMEM230 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY415474 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 |
USD 436.00 |
|
| LY423152 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 2 |
USD 436.00 |
|
| LY423153 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 4 |
USD 436.00 |
|
| LY425277 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 2 |
USD 396.00 |
|
| LY425278 | Transient overexpression lysate of chromosome 20 open reading frame 30 (C20orf30), transcript variant 4 |
USD 396.00 |
|
| PH313024 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009924) |
USD 2,055.00 |
|
| PH324414 | C20orf30 MS Standard C13 and N15-labeled recombinant protein (NP_001009925) |
USD 2,055.00 |
|
| TP301878 | Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 3 |
USD 823.00 |
|
| TP313024 | Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 2 |
USD 823.00 |
|
| TP324414 | Purified recombinant protein of Homo sapiens chromosome 20 open reading frame 30 (C20orf30), transcript variant 4 |
USD 748.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China