C20orf30 (TMEM230) (NM_001009924) Human Recombinant Protein

CAT#: TP313024

Recombinant protein of human chromosome 20 open reading frame 30 (C20orf30), transcript variant 2

Product Images

Coomassie blue staining of purified TMEM230 protein (Cat# TP313024). The protein was produced from HEK293T cells transfected with TMEM230 cDNA clone (Cat# RC213024) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC213024 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MMPSRTNLATGIPSSKVKYSRLSSTDDGYIDLQFKKTPPKIPYKAIALATVLFLIGAFLIIIGSLLLSGY
  ISKGGADRAVPVLIIGILVFLPGFYHLRIAYYASKGYRAYSYDDIPDFDD
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 13 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_001009924
• Locus ID: 29058
• UniProt ID: Q96A57
• Cytogenetics: 20p13-p12.3
• Refseq Size: 1792
• Refseq ORF: 360
• Synonyms: C20orf30; dJ1116H23.2.1; HSPC274
• Summary: This gene encodes a multi-pass transmembrane protein that belongs to the TMEM134/TMEM230 protein family. The encoded protein localizes to secretory and recycling vesicle in the neuron and may be involved in synaptic vesicles trafficking and recycling. Mutations in this gene may be linked to familial Parkinson's disease. [provided by RefSeq, Mar 2017]
• Protein Families: Transmembrane