PSMD10 (NM_002814) Human Mass Spec Standard

CAT#: PH302025

PSMD10 MS Standard C13 and N15-labeled recombinant protein (NP_002805)

Product Images

Coomassie blue staining of purified PSMD10 protein (Cat# TP302025). The protein was produced from HEK293T cells transfected with PSMD10 cDNA clone (Cat# RC202025) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202025
• Predicted MW: 24.4 kDa
• Protein Sequence:
  Sequence Link

  >RC202025 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD
  DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA
  TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ
  VAKGGLGLILKRMVEG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_002805
• RefSeq Size: 1585
• RefSeq ORF: 678
• Synonyms: dJ889N15.2; p28; p28(GANK)
• Locus ID: 5716
• UniProt ID: O75832
• Cytogenetics: Xq22.3
• Summary: 'This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011]'