PSMD10 (NM_002814) Human Recombinant Protein

CAT#: TP302025

Recombinant protein of human proteasome (prosome, macropain) 26S subunit, non-ATPase, 10 (PSMD10), transcript variant 1

Product Images

Coomassie blue staining of purified PSMD10 protein (Cat# TP302025). The protein was produced from HEK293T cells transfected with PSMD10 cDNA clone (Cat# RC202025) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Species: Human
• Expression Host: HEK293T
• Expression cDNA Clone or AA Sequence:
  Protein Sequence

  >RC202025 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MEGCVSNLMVCNLAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKD
  DAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEA
  TAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQ
  VAKGGLGLILKRMVEG
  
  myc-FLAG tag
• Tag: C-Myc/DDK
• Predicted MW: 24.2 kDa
• Concentration: >50 ug/mL as determined by microplate BCA method
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Buffer: 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Note: For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Storage: Store at -80°C.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

Reference Data

• RefSeq: NP_002805
• Locus ID: 5716
• UniProt ID: O75832
• Cytogenetics: Xq22.3
• Refseq Size: 1585
• Refseq ORF: 678
• Synonyms: dJ889N15.2; p28; p28(GANK)
• Summary: This gene encodes a subunit of the PA700/19S complex, which is the regulatory component of the 26S proteasome. The 26S proteosome complex is required for ubiquitin-dependent protein degradation. This protein is a non-ATPase subunit that may be involved in protein-protein interactions. Aberrant expression of this gene may paly a role in tumorigenesis. Two transcripts encoding different isoforms have been described. Pseudogenes have been identified on chromosomes 3 and 20.[provided by RefSeq, Mar 2011]