SNAP25 (NM_003081) Human Mass Spec Standard

CAT#: PH302068

SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_003072)

Product Images

Coomassie blue staining of purified SNAP25 protein (Cat# TP302068). The protein was produced from HEK293T cells transfected with SNAP25 cDNA clone (Cat# RC202068) using MegaTran 2.0 (Cat# TT210002).

Specifications

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: RC202068
• Predicted MW: 23.3 kDa
• Protein Sequence:
  Sequence Link

  >RC202068 protein sequence
  Red=Cloning site Green=Tags(s)
  
  MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQD
  MKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND
  ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG
  
  myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: 50 ug/ml as determined by BCA
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3. Store at -80°C. Avoid repeated freeze-thaw cycles. Stable for 3 months from receipt of products under proper storage and handling conditions.

Reference Data

• RefSeq: NP_003072
• RefSeq Size: 2069
• RefSeq ORF: 618
• Synonyms: bA416N4.2; CMS18; dJ1068F16.2; RIC-4; RIC4; SEC9; SNAP; SNAP-25; SUP
• Locus ID: 6616
• UniProt ID: P60880
• Cytogenetics: 20p12.2
• Summary: 'Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008]'
• Protein Families: Druggable Genome
• Protein Pathways: SNARE interactions in vesicular transport