SNAP25 (NM_003081) Human Recombinant Protein
CAT#: TP302068
Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1
View other "SNAP25" proteins (9)
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
USD 447.00
Specifications
| Product Data | |
| Species | Human |
| Expression Host | HEK293T |
| Expression cDNA Clone or AA Sequence |
>RC202068 protein sequence
Red=Cloning site Green=Tags(s) MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQD MKEAEKNLKDLGKCCGLFICPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Predicted MW | 23.2 kDa |
| Concentration | >50 ug/mL as determined by microplate BCA method |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
| Bioactivity | MS digestion standard (PMID: 25418885) |
| Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
| Storage | Store at -80°C. |
| Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Reference Data | |
| RefSeq | NP_003072 |
| Locus ID | 6616 |
| UniProt ID | P60880 |
| Cytogenetics | 20p12.2 |
| Refseq Size | 2069 |
| Refseq ORF | 618 |
| Synonyms | bA416N4.2; CMS18; dJ1068F16.2; RIC-4; RIC4; SEC9; SNAP; SNAP-25; SUP |
| Summary | Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
| Protein Pathways | SNARE interactions in vesicular transport |
Documents
| FAQs |
| SDS |
Resources
Recombinant Protein Resources |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408904 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC418912 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LC429993 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
| LY408904 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2 |
USD 436.00 |
|
| LY418912 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1 |
USD 436.00 |
|
| LY429993 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2 |
USD 396.00 |
|
| PH302068 | SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_003072) |
USD 2,055.00 |
|
| PH312596 | SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_570824) |
USD 2,055.00 |
|
| TP312596 | Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review
Germany
Japan
United Kingdom
China