SNAP25 (NM_130811) Human Recombinant Protein
CAT#: TP312596
Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2
View other "SNAP25" proteins (9)
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Specifications
Product Data | |
Species | Human |
Expression Host | HEK293T |
Expression cDNA Clone or AA Sequence |
>RC212596 representing NM_130811
Red=Cloning site Green=Tags(s) MAEDADMRNELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKD MKEAEKNLTDLGKFCGLCVCPCNKLKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTND ARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKMLGSG myc-FLAG tag |
Tag | C-Myc/DDK |
Predicted MW | 23.1 kDa |
Concentration | >50 ug/mL as determined by microplate BCA method |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Buffer | 25 mM Tris.HCl, pH 7.3, 100 mM glycine, 10% glycerol |
Preparation | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Note | For culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Storage | Store at -80°C. |
Stability | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Reference Data | |
RefSeq | NP_570824 |
Locus ID | 6616 |
UniProt ID | P60880 |
Cytogenetics | 20p12.2 |
Refseq Size | 2053 |
Refseq ORF | 618 |
Synonyms | bA416N4.2; CMS18; dJ1068F16.2; RIC-4; RIC4; SEC9; SNAP; SNAP-25; SUP |
Summary | Synaptic vesicle membrane docking and fusion is mediated by SNAREs (soluble N-ethylmaleimide-sensitive factor attachment protein receptors) located on the vesicle membrane (v-SNAREs) and the target membrane (t-SNAREs). The assembled v-SNARE/t-SNARE complex consists of a bundle of four helices, one of which is supplied by v-SNARE and the other three by t-SNARE. For t-SNAREs on the plasma membrane, the protein syntaxin supplies one helix and the protein encoded by this gene contributes the other two. Therefore, this gene product is a presynaptic plasma membrane protein involved in the regulation of neurotransmitter release. Two alternative transcript variants encoding different protein isoforms have been described for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Protein Pathways | SNARE interactions in vesicular transport |
Documents
FAQs |
SDS |
Resources
Recombinant Protein Resources |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408904 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC418912 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LC429993 | SNAP25 HEK293T cell transient overexpression lysate (as WB positive control) |
USD 121.00 |
|
LY408904 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2 |
USD 396.00 |
|
LY418912 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1 |
USD 396.00 |
|
LY429993 | Transient overexpression lysate of synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 2 |
USD 396.00 |
|
PH302068 | SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_003072) |
USD 2,055.00 |
|
PH312596 | SNAP25 MS Standard C13 and N15-labeled recombinant protein (NP_570824) |
USD 2,055.00 |
|
TP302068 | Recombinant protein of human synaptosomal-associated protein, 25kDa (SNAP25), transcript variant 1 |
USD 823.00 |
{0} Product Review(s)
Be the first one to submit a review